PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf08617g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CPP
Protein Properties Length: 979aa    MW: 105644 Da    PI: 6.019
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf08617g00004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR482.5e-15533570340
                       TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                               +k+CnCkkskClk+YC+Cfaag +C+ +C C++C+N+ 
  Niben101Scf08617g00004.1 533 CKRCNCKKSKCLKLYCDCFAAGIYCAGSCACQGCFNRI 570
                               79**********************************86 PP

2TCR48.51.8e-15647685139
                       TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                               ++k+gC+Ckks ClkkYCeC++a++ Cs+ C+Ce+CkN 
  Niben101Scf08617g00004.1 647 RHKRGCSCKKSMCLKKYCECYQANVGCSSGCRCEGCKNV 685
                               589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.2E-14531572IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.154532687IPR005172CRC domain
PfamPF036383.0E-11534569IPR005172CRC domain
SMARTSM011145.5E-17647688IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.1E-11649684IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 979 aa     Download sequence    Send to blast
MDSPEPSSKT ATINSTINST PAEDSPVFSY ISNLSPIQPV KAAPVVQGFP GLNSPPLLFT  60
SPQVSAHSRL RRSQFPQLSS EVFSGKNEDY NNAITDSDGN GVAVSQLRSE LSPSVQKAPD  120
NNISVPDESG SLIRSGDEFL VDVLNSESAN PSNSTNPSPK VADNIPQSPN SAAESFADFA  180
SKDARKDEIP KDAARIVVEQ AEEENKGKSS SDQKDNGIYN TSTDSDLPSP DLCTKIEPDL  240
PADNSLHYHY SDRQMAQLSR ADHAMLDETS DIQTEPLETA HDCRNDNDKI NSMSSAPDEC  300
IMQHDSQTKA GIYQSGIRRR CLQFEDAQRK ISPTSLGLQS TSDIVSCSIP PVSPAVIEVV  360
ASGSSNRSST ASNRPSTQLT SSSDNFESFG VKVPKPSGIG LHLNSIAMQA GSRATVSVKS  420
AERGNLSISG KKLTSMMSCH PSENLKSCSI SSNVVGSHLT IGDNDGENES YGTKAESAAS  480
LHLNDAKPLN NTVLLKPTEH TISHKRKSSS EYIDGPMNYN QKKPSDAYDG DGCKRCNCKK  540
SKCLKLYCDC FAAGIYCAGS CACQGCFNRI EYEDTVNDVR QQIQSRNPLA FCPKIVQHPT  600
DSPESILGVF NSSESFFYSG SSIFSRLTYL LAILQVEGAS CTPPSARHKR GCSCKKSMCL  660
KKYCECYQAN VGCSSGCRCE GCKNVYGLKE EYSKDLVKKH CITGRLEKSV EEKVEMVTAT  720
SGLLQIDPRL QCNLTPPTPS FQSSNRGKNA SKSWFTSGRY LSSPESGQAI YGLSPASPTS  780
SKNHDIDQET TGDIMDLVTF DQEFNYGNAN LANEFSPGFH VTGNTDDLLA LPKSQDLASN  840
IGGQPIPQTV HFPSTWPLSW RDSPITPMNQ FDGSGMNALE LLNSDKKPYA MEDDTPEILK  900
DSSMPQTGVK VSSPNKKRIS PPNRHLNELG SSSSGGGLKT GRKFILRAVP SFPPLTPCID  960
SKDVTTHSAD NSQKSSSGK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009763114.10.0PREDICTED: CRC domain-containing protein TSO1-like
TrEMBLK4CLU10.0K4CLU1_SOLLC; Uncharacterized protein
STRINGSolyc08g067150.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA69802128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.15e-51Tesmin/TSO1-like CXC domain-containing protein